Tested Applications
| Positive WB detected in | BxPC-3 cells, SW480 cells, HCT 116 cells, HT-29 cells, NCCIT cells, PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86714-3-RR targets SOX9 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26274 Product name: Recombinant human SOX9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 306-405 aa of NM_000346 Sequence: MVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPS Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 9 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | NM_000346 |
| Gene Symbol | SOX9 |
| Gene ID (NCBI) | 6662 |
| RRID | AB_3745073 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48436 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor. SOX9 can be ubiquitinated or SUMOylated to higher molecular weight (PMID: 24155239; 16307912; 16554309; 32070068)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SOX9 antibody 86714-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



