SP100 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84012-5-RR (same clone as 84012-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84012-5-RR (SP100 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84012-5-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 84012-5-RR (same clone as 84012-5-PBS)

  WB result of SP100 antibody (84012-5-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-SP100 transfected A431 cells. This data was developed using the same antibody clone with 84012-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 84012-5-RR (same clone as 84012-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84012-5-RR (SP100 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with . This data was developed using the same antibody clone with 84012-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 84012-5-RR (same clone as 84012-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84012-5-RR (SP100 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with . This data was developed using the same antibody clone with 84012-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 84012-5-RR (same clone as 84012-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SP100 antibody (84012-5-RR, Clone: 241153F8 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84012-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 84012-5-RR (same clone as 84012-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SP100 antibody (84012-5-RR, Clone: 241153F8 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84012-5-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SP100 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84012-5-PBS

Clone No.241153F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

241153F8, Nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP 100, SP100 nuclear antigen

---

Product Information

84012-5-PBS targets SP100 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35193

  Product name: Recombinant human SP100 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 141-300 aa of BC011562

  Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK

• Full Name: SP100 nuclear antigen
• Calculated Molecular Weight: 879 aa, 100 kDa
• Observed Molecular Weight: 70-100 kDa, 110-140 kDa
• GenBank Accession Number: BC011562
• Gene Symbol: SP100
• Gene ID (NCBI): 6672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P23497
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains. Sp100 is an acidic protein that exerts a highly aberrant electrophoretic mobility in SDS-polyacrylamide gel electrophoresis.