CoraLite® Plus 488-conjugated SP100 Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-84012-5

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 SP100 antibody (CL488-84012-5, Clone: 241153F8 ) at dilution of 1:200, Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

SP100 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84012-5

Clone No.241153F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241153F8, Nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP 100, SP100 nuclear antigen

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84012-5 targets SP100 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35193

  Product name: Recombinant human SP100 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 141-300 aa of BC011562

  Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK

• Full Name: SP100 nuclear antigen
• Calculated Molecular Weight: 879 aa, 100 kDa
• Observed Molecular Weight: 70-100 kDa, 110-140 kDa
• GenBank Accession Number: BC011562
• Gene Symbol: SP100
• Gene ID (NCBI): 6672
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23497
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains. Sp100 is an acidic protein that exerts a highly aberrant electrophoretic mobility in SDS-polyacrylamide gel electrophoresis.