SP110 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SP110 Polyclonal antibody, PBS Only (11502-1-PBS)

• 

  WB analysis of HeLa using 11502-1-AP (same clone as 11502-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11502-1-AP (same clone as 11502-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 11502-1-AP (same clone as 11502-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11502-1-AP (same clone as 11502-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 11502-1-AP (same clone as 11502-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 11502-1-AP (same clone as 11502-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse small intestine using 11502-1-AP (same clone as 11502-1-PBS)

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 11502-1-AP (same clone as 11502-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 11502-1-AP (same clone as 11502-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 11502-1-AP (SP110 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 11502-1-AP (same clone as 11502-1-PBS)

  IP result of anti-SP110 (IP:11502-1-AP, 4ug; Detection:11502-1-AP 1:800) with HeLa cells lysate 4000ug. This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 11502-1-AP (same clone as 11502-1-PBS)

  1X10^6 Jurkat cells were intracellularly stained with 0.2 ug Anti-Human SP110 (11502-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 11502-1-PBS in a different storage buffer formulation.

SP110 Polyclonal Antibody for WB, FC (Intra), IP, Indirect ELISA

Cat No. 11502-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, Indirect ELISA

Synonyms

---

Product Information

11502-1-PBS targets SP110 in WB, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2042

  Product name: Recombinant human SP110 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC019059

  Sequence: MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILTQLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYERQSRDTPILLEAPTGLAEGSSLHTPLALPPPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPRALSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEII

• Full Name: SP110 nuclear body protein
• Calculated Molecular Weight: 689 aa, 79 kDa
• Observed Molecular Weight: 62-66 kDa
• GenBank Accession Number: BC019059
• Gene Symbol: SP110
• Gene ID (NCBI): 3431
• RRID: AB_10863116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB58
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.