SPA17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPA17 Polyclonal antibody, PBS Only (13367-1-PBS)

• 

  WB analysis using 13367-1-AP (same clone as 13367-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13367-1-AP (SPA17 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13367-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 13367-1-AP (same clone as 13367-1-PBS)

  IP result of anti-SPA17 (IP:13367-1-AP, 4ug; Detection:13367-1-AP 1:5000) with mouse testis tissue lysate 1520 ug. This data was developed using the same antibody clone with 13367-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 13367-1-AP (same clone as 13367-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13367-1-AP (SPA17 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13367-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 13367-1-AP (same clone as 13367-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13367-1-AP (SPA17 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13367-1-PBS in a different storage buffer formulation.

SPA17 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13367-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CT22, SP17, SP17 1, Sp17-1, SPA 17

---

Product Information

13367-1-PBS targets SPA17 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4186

  Product name: Recombinant human SPA17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC032457

  Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK

• Full Name: sperm autoantigenic protein 17
• Calculated Molecular Weight: 151 aa, 17 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC032457
• Gene Symbol: SPA17
• Gene ID (NCBI): 53340
• RRID: AB_2194631
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15506
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sperm surface protein Sp17(SPA17)is a 151 amino acids protein (17kDa), which is a sperm surface peripheral membrane protein. It is a highly conserved mammalian protein expressed in developing spermatozoa and mature spermatids, and reported to play a role in the interaction of sperm with the zona pellucida. SP17 exists as a homodimer and localizes to the head and tail of spermatozoa. SP17 has been identified as a cancer/testis antigen and is expressed in ovarian cancer and multiple myeloma. This suggests that SP17 could be suitable as a target in tumor immunotherapy.