SPAG16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPAG16 Polyclonal antibody, PBS Only (16883-1-PBS)

• 

  WB analysis of rat testis using 16883-1-AP (same clone as 16883-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 16883-1-AP (SPAG16 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16883-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 16883-1-AP (same clone as 16883-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16883-1-AP (SPAG16 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16883-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 16883-1-AP (same clone as 16883-1-PBS)

  IP result of anti-SPAG16 (IP:16883-1-AP, 4ug; Detection:16883-1-AP 1:1000) with mouse testis tissue lysate 4000ug. This data was developed using the same antibody clone with 16883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 16883-1-AP (same clone as 16883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 16883-1-AP (SPAG16 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 16883-1-AP (same clone as 16883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 16883-1-AP (SPAG16 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16883-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16883-1-AP (same clone as 16883-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using SPAG16 antibody 16883-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 16883-1-PBS in a different storage buffer formulation.

SPAG16 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16883-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

16883-1-PBS targets SPAG16 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10348

  Product name: Recombinant human SPAG16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC009614

  Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYV

• Full Name: sperm associated antigen 16
• Calculated Molecular Weight: 631 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC009614
• Gene Symbol: SPAG16
• Gene ID (NCBI): 79582
• RRID: AB_2194658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0X2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPAG16 (also known as PF20) is an orthologue of Chlamydomonas PF20, a component of the alga axoneme central apparatus that is required for flagellar motility. SPAG16 is highly expressed in the testis, low abundant or absent from other tissues. The SPAG16 gene encodes two major proteins, a 71-kDa SPAG16L and a smaller 35-kDa SPAG16S nuclear protein that represents the C-terminus of SPAG16L. SPAG16L was detected abundantly in the cytoplasm, while SPAG16S was detected in both cytoplasm and nucleus. This antibody was raised against the N-terminal region of SPAG16 and mainly recognizes SPAG16L.