SPAG5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPAG5 Polyclonal antibody, PBS Only (14726-1-PBS)

• 

  WB analysis using 14726-1-AP (same clone as 14726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14726-1-AP (SPAG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14726-1-AP (same clone as 14726-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 14726-1-AP (SPAG5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 14726-1-AP (same clone as 14726-1-PBS)

  IP result of anti-SPAG5 (IP:14726-1-AP, 5ug; Detection:14726-1-AP 1:1000) with HeLa cells lysate 3000ug. This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14726-1-AP (same clone as 14726-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14726-1-AP (SPAG5 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14726-1-AP (same clone as 14726-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14726-1-AP (SPAG5 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14726-1-AP (same clone as 14726-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14726-1-AP (SPAG5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14726-1-AP (same clone as 14726-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SPAG5 antibody (14726-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14726-1-AP (same clone as 14726-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SPAG5 antibody (14726-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 14726-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SPAG5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14726-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

sperm associated antigen 5, Mitotic spindle-associated protein p126, MAP126, hMAP126, Deepest

---

Product Information

14726-1-PBS targets SPAG5 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6485

  Product name: Recombinant human SPAG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 844-1193 aa of BC000322

  Sequence: TVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS

• Full Name: sperm associated antigen 5
• Calculated Molecular Weight: 134 kDa
• Observed Molecular Weight: 135 kDa, 150 kDa
• GenBank Accession Number: BC000322
• Gene Symbol: SPAG5
• Gene ID (NCBI): 10615
• RRID: AB_2194787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96R06
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPAG5, also named as MAP126, Astrin and Deepest, is necessary for normal spindle formation during mitosis. It is highly expressed in testis. SPAG5 has different localization in somatic versus male germ cells suggesting the possibility of different function. This antibody is specific to SPAG5.