SPAG9 Polyclonal antibody

• 

  WB analysis using 24423-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24423-1-AP (SPAG9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24423-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24423-1-AP (SPAG9 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 24423-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 24423-1-AP (SPAG9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 24423-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24423-1-AP (SPAG9 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 24423-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24423-1-AP (SPAG9 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 24423-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SPAG9 antibody (24423-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  IF Staining of RAW 264.7 using 24423-1-AP

  Immunofluorescent analysis of RAW 264.7 cells using 24423-1-AP (SPAG9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

SPAG9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24423-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HLC-6, HLC4, HLC 6, CT89, C-Jun-amino-terminal kinase-interacting protein 4

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, RAW 264.7 cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24423-1-AP targets SPAG9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19763

  Product name: Recombinant human SPAG9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 199-273 aa of BC146755

  Sequence: ERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSK

• Full Name: sperm associated antigen 9
• Calculated Molecular Weight: 1321 aa, 146 kDa
• Observed Molecular Weight: 146 kDa
• GenBank Accession Number: BC146755
• Gene Symbol: SPAG9
• Gene ID (NCBI): 9043
• RRID: AB_2879541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60271
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.