SPANXE Polyclonal antibody

• 

  WB analysis of A375 using 15870-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 15870-1-AP (SPANXE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skin using 15870-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 15870-1-AP (SPANXE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A375 using 15870-1-AP

  Immunofluorescent analysis of A375 cells using 15870-1-AP (SPANXE antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

SPANXE Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15870-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

SPANX C, SPANX A2, Nuclear-associated protein SPAN-Xc, CT11.3, Cancer/testis-associated protein CTp11

---

Tested Applications

• Positive WB detected in: A375 cells, mouse skin tissue
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15870-1-AP targets SPANXE in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8572

  Product name: Recombinant human SPANXE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-97 aa of BC005382

  Sequence: MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNVKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK

• Full Name: SPANX family, member E
• Calculated Molecular Weight: 97 aa, 11 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC005382
• Gene Symbol: SPANXE
• Gene ID (NCBI): 171489
• RRID: AB_10951107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAD1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPANXE (Sperm protein associated with the nucleus on the X chromosome E), also known as SPANX A2 or SPANX C, is a member of the SPANX family. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene encodes a sperm protein that contains a consensus nuclear localization signal but, although a role in spermatogenesis is suggested, the specific function of this family member has not yet been determined.