SPATA13 Polyclonal antibody

• 

  WB analysis of COLO 320 using 21400-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 21400-1-AP (SPATA13 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 21400-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 21400-1-AP (SPATA13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 21400-1-AP

  Immunofluorescent analysis of HepG2 cells, using SPATA13 antibody 21400-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• 

  IF Staining of HeLa using 21400-1-AP

  Immunofluorescent analysis of Hela cells, using SPATA13 antibody 21400-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of HEK-293 using 21400-1-AP

  Immunofluorescent analysis of 293 cells, using SPATA13 antibody 21400-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

SPATA13 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21400-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Spermatogenesis-associated protein 13, spermatogenesis associated 13, Asef2

---

Tested Applications

• Positive WB detected in: COLO 320 cells, human placenta tissue
• Positive IF/ICC detected in: HepG2 cells, HEK-293 cells, Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21400-1-AP targets SPATA13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16101

  Product name: Recombinant human SPATA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC109291

  Sequence: MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGG

• Full Name: spermatogenesis associated 13
• Calculated Molecular Weight: 652 aa, 75 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC109291
• Gene Symbol: SPATA13
• Gene ID (NCBI): 221178
• RRID: AB_10859783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96N96
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.