SPATA13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPATA13 Polyclonal antibody, PBS Only (21400-1-PBS)

• 

  WB analysis of COLO 320 using 21400-1-AP (same clone as 21400-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 21400-1-AP (SPATA13 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21400-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 21400-1-AP (same clone as 21400-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 21400-1-AP (SPATA13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21400-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21400-1-AP (same clone as 21400-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using SPATA13 antibody 21400-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 21400-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21400-1-AP (same clone as 21400-1-PBS)

  Immunofluorescent analysis of Hela cells, using SPATA13 antibody 21400-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 21400-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 21400-1-AP (same clone as 21400-1-PBS)

  Immunofluorescent analysis of 293 cells, using SPATA13 antibody 21400-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 21400-1-PBS in a different storage buffer formulation.

SPATA13 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 21400-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21400-1-PBS targets SPATA13 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16101

  Product name: Recombinant human SPATA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC109291

  Sequence: MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGG

• Full Name: spermatogenesis associated 13
• Calculated Molecular Weight: 652 aa, 75 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC109291
• Gene Symbol: SPATA13
• Gene ID (NCBI): 221178
• RRID: AB_10859783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96N96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.