SPATA16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPATA16 Polyclonal antibody, PBS Only (17357-1-PBS)

• 

  IHC staining of human testis using 17357-1-AP (same clone as 17357-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17357-1-AP (SPATA16 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17357-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17357-1-AP (same clone as 17357-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17357-1-AP (SPATA16 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17357-1-PBS in a different storage buffer formulation.

SPATA16 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 17357-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

17357-1-PBS targets SPATA16 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10637

  Product name: Recombinant human SPATA16 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 221-570 aa of BC034496

  Sequence: EDIASVASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAYFRNHLRQATVFRCLERYSEAARSAMIADYMFWLGGGREESISKLIKLYWQAMIEEAITRAESFSVMYTPFATKIRADKIEKVKDAFTKTHPAYAEYMYTDLQALHMLPQTVDWSSFPPQQYLLTLGFKNKDDGKFLEKISSRKLPIFTEHKTPFGLTREDTVRQMETMGKRILPILDFIRSTQLNGSFPASSGVMEKLQYASLLSQLQRVKEQSQVINQAMAELATIPYLQDISQQEAELLQSLMADAMDTLEGRRNNNERVWNMIQKVGQIEDFLYQLEDSFLKTKKLRTARRQKTKMKRLQTVQQR

• Full Name: spermatogenesis associated 16
• Calculated Molecular Weight: 569 aa, 65 kDa
• GenBank Accession Number: BC034496
• Gene Symbol: SPATA16
• Gene ID (NCBI): 83893
• RRID: AB_2878396
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPATA16, also named as NYD-SP12, belongs to the SPATA16 family. It is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. SPATA16 localizes to Golgi apparatus and is primarily expressed in testis, with lower levels found in kidney and pancreas.