SPATA6 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SPATA6 Recombinant monoclonal antibody (87341-1-RR)

• 

  WB analysis of mouse testis using 87341-1-RR

  Mouse testis tissue were subjected to SDS PAGE followed by western blot with 87341-1-RR (SPATA6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 87341-1-RR

  Mouse ovary tissue were subjected to SDS PAGE followed by western blot with 87341-1-RR (SPATA6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

SPATA6 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87341-1-RR

Clone No.252546E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

HASH, Spermatogenesis-associated protein 6, SRF 1, SRF1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, mouse ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87341-1-RR targets SPATA6 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag41247

  Product name: Recombinant human SPATA6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 167-472 aa of BC020660

  Sequence: YHLAPVEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHVDPPSPRADTLLGSSGRDCERDGWSRVHNDHSHLGCCRPKDYKVIRTPHGRDFDDSLEKCEEYLSPRSCSKPRHSARTLLVHSAPSTMPKHSPSPVLNRASLRERFHSDWCSPSNCDEIHDRDERDLEKDDELELKRSLLCRDSAYDSDPEYSSCQQPRGTFHLDDGEYWSNRAASYKGKSHRPIFENSMDKMYRNLYKKACSSASHTQESF

• Full Name: spermatogenesis associated 6
• Calculated Molecular Weight: 472 aa, 54 kDa
• Observed Molecular Weight: 54-60 kDa
• GenBank Accession Number: BC020660
• Gene Symbol: SPATA6
• Gene ID (NCBI): 54558
• RRID: AB_3745478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NWH7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Spermatogenesis-associated protein 6 (SPATA6) is a testis-enriched protein crucial for spermatogenesis and male fertility. It localizes to the sperm head-tail coupling apparatus (HTCA) and is crucial for the proper assembly of the sperm connecting piece and tight head-tail conjunction. SPATA6 is a core structural component of the sperm fibrous sheath (FS), a cytoskeletal structure in the principal piece of the sperm flagellum essential for normal sperm motility. Mutations in SPATA6 can lead to acephalic spermatozoa and male infertility (PMID: 38454159, PMID: 41058548).