SPC24 Polyclonal antibody

• 

  WB analysis using 26268-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26268-1-AP (SPC24 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

SPC24 Polyclonal Antibody for WB, ELISA

Cat No. 26268-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

hSpc24, Kinetochore protein Spc24, SPBC24, SPC24

---

Tested Applications

• Positive WB detected in: HEK-293T cells, Hela cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below

Product Information

26268-1-AP targets SPC24 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23256

  Product name: Recombinant human SPC24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-197 aa of BC105037

  Sequence: MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW

• Full Name: SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae)
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC105037
• Gene Symbol: SPC24
• Gene ID (NCBI): 147841
• RRID: AB_2880453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	FASEB J; Spindle pole body component 24 homolog potentiates tumor progression via regulation of SRY-box transcription factor 2 in clear cell renal cell carcinoma.; Authors - Chengfang Sun
human	WB	Gene; SPC24 Regulates breast cancer progression by PI3K/AKT signaling.; Authors - Juan Zhou ; KD Validated