SPCS1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPCS1 Polyclonal antibody (11847-1-AP)

• Featured Product
• KD/KO Validated

SPCS1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 11847-1-AP Copied!

Publications (8)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, CoIP, ELISA

Synonyms

SPC12, SPC1, SPase 12 kDa subunit, HSPC033

• 

  WB analysis using 11847-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11847-1-AP (SPCS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skin using 11847-1-AP

  human skin tissue were subjected to SDS PAGE followed by western blot with 11847-1-AP (SPCS1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 11847-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11847-1-AP (SPCS1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of BxPC-3 using 11847-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using SPCS1 antibody (11847-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPCS1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, human skin tissue, PC-3 cells
• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11847-1-AP targets SPCS1 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2407

  Product name: Recombinant human SPCS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC000884

  Sequence: MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAK

• Full Name: signal peptidase complex subunit 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 102 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC000884
• Gene Symbol: SPCS1
• Gene ID (NCBI): 28972
• RRID: AB_2195400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6A9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SPCS1 antibody (Cat# 11847-1-AP) has 8 total citations appearing in Nature, Molecular Cell, PLoS Pathogens, iScience, and bioRxiv. Research fields include signal peptidase complex-mediated viral protein processing in flaviviruses, hepatitis C virus, rotavirus, HTLV-1, and tick-borne encephalitis virus, as well as ER-to-nucleus signaling pathways and virus-host interactome studies.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A CRISPR screen defines a signal peptide processing pathway required by flaviviruses.; Authors - Rong Zhang ; KO Validated
human	WB	Mol Cell; Cleavage of the pseudoprotease iRhom2 by the signal peptidase complex reveals an ER-to-nucleus signaling pathway; Authors - Iqbal Dulloo
human	WB	PLoS Pathog; Signal peptidase complex mediates rotavirus VP7 processing and virion assembly.; Authors - Xuejiao Zhu ; KO Validated
human	WB	PLoS Pathog; HTLV-1 p12 is cleaved to p8 by the signal peptidase complex and its inhibition impairs p8-dependent transmission.; Authors - Florian Simon ; KD Validated
human	WB	PLoS Pathog; Signal Peptidase Complex Subunit 1 Participates in the Assembly of Hepatitis C Virus through an Interaction with E2 and NS2.; Authors - Suzuki Ryosuke R ; KD Validated
	WB	PLoS Pathog; SPCS1-Dependent E2-p7 processing determines HCV Assembly efficiency.; Authors - Nabeel Alzahrani

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

This product has received one review with a perfect 5-star rating. The reviewer used it for Western Blot on 293T cells at a 1:500 dilution and reported highly specific results, noting a clean single band at the expected ~12 kDa size with low background. Overall, the feedback is positive, highlighting the antibody's specificity and low background performance in WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Joao (Verified Customer) (10-09-2019)

Specific, single band (~12kDa), low background

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: 293T

SPCS1 Antibody Western Blot, validation (1:500 dilution) in 293T (Cat no:11847-1-AP)