SPCS1 Polyclonal antibody

• 

  WB analysis using 11847-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11847-1-AP (SPCS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 11847-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11847-1-AP (SPCS1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skin using 11847-1-AP

  human skin tissue were subjected to SDS PAGE followed by western blot with 11847-1-AP (SPCS1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IF Staining of BxPC-3 using 11847-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using SPCS1 antibody (11847-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

SPCS1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 11847-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

SPC12, SPC1, SPase 12 kDa subunit, HSPC033

---

Tested Applications

• Positive WB detected in: HeLa cells, human skin tissue, PC-3 cells
• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below

Product Information

11847-1-AP targets SPCS1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2407

  Product name: Recombinant human SPCS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC000884

  Sequence: MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAK

• Full Name: signal peptidase complex subunit 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 102 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC000884
• Gene Symbol: SPCS1
• Gene ID (NCBI): 28972
• RRID: AB_2195400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6A9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A CRISPR screen defines a signal peptide processing pathway required by flaviviruses.; Authors - Rong Zhang ; KO Validated
human	WB	PLoS Pathog; Signal Peptidase Complex Subunit 1 Participates in the Assembly of Hepatitis C Virus through an Interaction with E2 and NS2.; Authors - Suzuki Ryosuke R ; KD Validated
	WB	PLoS Pathog; SPCS1-Dependent E2-p7 processing determines HCV Assembly efficiency.; Authors - Nabeel Alzahrani
human	WB	Mol Cell; Cleavage of the pseudoprotease iRhom2 by the signal peptidase complex reveals an ER-to-nucleus signaling pathway; Authors - Iqbal Dulloo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joao (Verified Customer) (10-09-2019)

Specific, single band (~12kDa), low background

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: 293T

SPCS1 Antibody Western Blot, validation (1:500 dilution) in 293T (Cat no:11847-1-AP)