SPDEF Monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• SPDEF Monoclonal antibody, PBS Only (Detector) (68716-1-PBS)

SPDEF Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 68716-1-PBS

Clone No.2A1C1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

bA375E1.3, PDEF, Prostate derived Ets factor, Prostate epithelium-specific Ets transcription factor, Prostate specific Ets

• 

  WB analysis using 68716-1-Ig (same clone as 68716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68716-1-Ig (SPDEF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68716-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP51889-1

  Cytometric bead array sample test of MP51889-1, SPDEF Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68716-2-PBS. Detection antibody: 68716-1-PBS.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP51889-1

  Cytometric bead array standard curve of MP51889-1, SPDEF Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68716-2-PBS. Detection antibody: 68716-1-PBS. Standard:Ag33739. Range: 0.781-100 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

68716-1-PBS targets SPDEF as part of a matched antibody pair:

MP51889-1: 68716-2-PBS capture and 68716-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33739

  Product name: Recombinant human SPDEF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-335 aa of BC021299

  Sequence: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

• Full Name: SAM pointed domain containing ets transcription factor
• Calculated Molecular Weight: 335 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC021299
• Gene Symbol: SPDEF
• Gene ID (NCBI): 25803
• RRID: AB_3670409
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O95238
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.