SPDEF Monoclonal antibody, PBS Only

• 

  WB analysis using 68716-1-Ig (same clone as 68716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68716-1-Ig (SPDEF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68716-1-PBS in a different storage buffer formulation.

SPDEF Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68716-1-PBS

Clone No.2A1C1

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

bA375E1.3, PDEF, Prostate derived Ets factor, Prostate specific Ets, PSE, RP11 375E1__A.3, SPDEF

---

Product Information

68716-1-PBS targets SPDEF in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33739

  Product name: Recombinant human SPDEF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-335 aa of BC021299

  Sequence: MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

• Full Name: SAM pointed domain containing ets transcription factor
• Calculated Molecular Weight: 335 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC021299
• Gene Symbol: SPDEF
• Gene ID (NCBI): 25803
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O95238
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.