SPDYC Polyclonal antibody

• 

  IHC staining of human liver using 22471-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22471-1-AP (SPDYC antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 22471-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22471-1-AP (SPDYC antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 22471-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22471-1-AP (SPDYC antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 22471-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22471-1-AP (SPDYC antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 22471-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22471-1-AP (SPDYC antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 22471-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22471-1-AP (SPDYC antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SPDYC Polyclonal Antibody for IHC, ELISA

Cat No. 22471-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

hSpy/Ringo C, RINGO C, Ringo2, SPDYC, Speedy protein C

---

Tested Applications

• Positive IHC detected in: human liver tissue, human kidney tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22471-1-AP targets SPDYC in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18126

  Product name: Recombinant human SPDYC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-293 aa of BC137244

  Sequence: MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH

• Full Name: speedy homolog C (Xenopus laevis)
• Calculated Molecular Weight: 293 aa, 33 kDa
• Observed Molecular Weight: 33-40 kDa
• GenBank Accession Number: BC137244
• Gene Symbol: SPDYC
• Gene ID (NCBI): 387778
• RRID: AB_3085699
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5MJ68
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPDYC(Speedy protein C), also known as RINGOC and Ringo2, promotes progression through the cell cycle via binding and activation of CDK1 and CDK2. Downregulation of SPDYC inhibits cell growth, reduces the fraction of cells in G1, and increases the S and G2 populations(PMID: 18802405). SPDYC is involved in the spindle-assembly checkpoint and required for recruitment of MAD2L1, BUBR1 and BUB1 to kinetochores(Uniprot).