• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SPERT Polyclonal antibody

SPERT Polyclonal Antibody for IF/ICC
Cat No. CL488-17826

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Spermatid-associated protein, Spermatid associated protein, spermatid associated, Protein chibby homolog 2, NURIT

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17826 targets SPERT in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12200

Product name: Recombinant human SPERT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-412 aa of BC027609

Sequence: MQPEGLKCRMEESNAERGTAEPFPRLHNLYSTPRCAQQAALPRLSRRMASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHKRLAKECMLQEENKSLREENKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAYWAQAEDTAAPAEESKPAPSPHEEPCSPGLLQDQGSGLSSRFEEPKGPPARQEDSKELRALRKMVSNMSGPSGEEEAKVGPGLPDGCQPLQLLREMRQALQALLKENRLLQEENRTLQVLRAEHRGFQEENKALWENNKLKLQQKLVIDTVTEVTARMEMLIEELYAFMPARSQDPKKPSRV

Predict reactive species
Full Name spermatid associated
Calculated Molecular Weight 448 aa, 47 kDa, 52 kDa
Observed Molecular Weight 48-52 kDa
GenBank Accession NumberBC027609
Gene Symbol SPERT
Gene ID (NCBI) 220082
RRIDAB_3672683
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NA61
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SPERT (spermatid associated protein), also known as CBY2 (chibby homolog 2) or NURIT, is a novel leucine-zipper protein belonging to the chibby family of proteins [PMID:12204287]. Uniquely expressed in the spermatid flower-like structure, SPERT interacts with Nek1, a member of the NIMA-family kinase family that is associated centrosomal stability and ciliogenesis. It contains a leucine-zipper motif and two coiled-coil regions, and is transcribed through the elongation stage of the spermatids. SPERT is absent from mature spermatozoa and is thought to be involved in transporting proteins that are to be discarded via the residual bodies. [PMID:12204287]

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SPERT antibody CL488-17826Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...