Home
Products
Primary Antibodies
SPG7 Polyclonal antibody, PBS Only (27801-1-PBS)

Filter: AllWBIPIHC

WB analysis using 27801-1-AP (same clone as 27801-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27801-1-AP (SPG7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27801-1-PBS in a different storage buffer formulation.
IP experiment of HeLa using 27801-1-AP (same clone as 27801-1-PBS)
IP result of anti-SPG7 (IP:27801-1-AP, 4ug; Detection:27801-1-AP 1:500) with HeLa cells lysate 2800 ug. This data was developed using the same antibody clone with 27801-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 27801-1-AP (same clone as 27801-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27801-1-AP (SPG7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27801-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 27801-1-AP (same clone as 27801-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27801-1-AP (SPG7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27801-1-PBS in a different storage buffer formulation.

SPG7 Polyclonal antibody, PBS Only

Name: SPG7 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 27801-1-PBS

SPG7 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 27801-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CAR, CMAR, EC:3.4.24.-, Mitochondrial inner membrane m-AAA protease component paraplegin, Paraplegin

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

27801-1-PBS targets SPG7 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26265 Product name: Recombinant human SPG7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-45 aa of BC007692 Sequence: VATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVY Predict reactive species
Full Name	spastic paraplegia 7 (pure and complicated autosomal recessive)
Calculated Molecular Weight	88 kDa
Observed Molecular Weight	54 kDa, 70 kDa, 80kDa
GenBank Accession Number	BC007692
Gene Symbol	SPG7
Gene ID (NCBI)	6687
RRID	AB_2918133
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UQ90
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SPG7 encodes a nuclear-encoded mitochondrial metalloprotease protein that is a member of the AAA protein family. Two transcript variants encoding distinct isoforms have been identified. The molecular weight of SPG7 is about 88-100 kDa (precursor),80 kDa (intermediate) and 70 kDa (mature)(PMID: 24767997), while the molecular weight of isoform 2 is about 54 kDa.