SPIN1 Recombinant monoclonal antibody

• 

  WB analysis using 86848-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86848-3-RR (SPIN1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

SPIN1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86848-3-RR

Clone No.251836E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

OCR, Ovarian cancer-related protein, SPIN, SPIN 1, spindlin 1

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-3 cells, mouse brain tissue, rat brain tissue, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86848-3-RR targets SPIN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2750

  Product name: Recombinant human SPIN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-262 aa of BC013571

  Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

• Full Name: spindlin 1
• Calculated Molecular Weight: 262 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC013571
• Gene Symbol: SPIN1
• Gene ID (NCBI): 10927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y657
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPIN1 (Spindlin 1) is a histone methylation reader, which recognizes trimethylated histone H3 lysine 4 through the protein-protein interaction. SPIN1 was initially found in ovarian cancer via searching ovarian cancer-related genes . It is overexpressed in ovarian cancer tissue, which exhibits a high homology to mouse Spin (Spindlin) gene. Signaling pathways responsible for SPIN1 functions include PI3K/Akt, Wnt and RET that are highly relevant to tumorigenesis.(PMID: 34492335, PMID: 31790762)