SPINK5L3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPINK5L3 Polyclonal antibody, PBS Only (24656-1-PBS)

• 

  IHC staining of rat testis using 24656-1-AP (same clone as 24656-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 24656-1-AP (SPINK5L3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24656-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24656-1-AP (same clone as 24656-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24656-1-AP (SPINK5L3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24656-1-PBS in a different storage buffer formulation.

SPINK5L3 Polyclonal Antibody for IHC, ELISA

Cat No. 24656-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

HBVDNAPTP1, HESPINTOR, serine PI Kazal type 5 like 3, SPINK13

---

Product Information

24656-1-PBS targets SPINK5L3 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19715

  Product name: Recombinant human SPINK5L3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-94 aa of BC128164

  Sequence: KMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD

• Full Name: serine PI Kazal type 5-like 3
• Calculated Molecular Weight: 94 aa, 11 kDa
• GenBank Accession Number: BC128164
• Gene Symbol: SPINK5L3
• Gene ID (NCBI): 153218
• RRID: AB_3742120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q1W4C9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPINK5L3 (Serine protease inhibitor Kazal-type 13) may be a serine protease inhibitor. It enables serine-type endopeptidase inhibitor activity, which is involved in the negative regulation of the acrosome reaction.