Product Information
21155-1-PBS targets SPINK7 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15727 Product name: Recombinant human SPINK7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC109385 Sequence: MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC Predict reactive species |
| Full Name | serine peptidase inhibitor, Kazal type 7 (putative) |
| Calculated Molecular Weight | 85 aa, 9 kDa |
| GenBank Accession Number | BC109385 |
| Gene Symbol | SPINK7 |
| Gene ID (NCBI) | 84651 |
| RRID | AB_3085640 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P58062 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SPINK7, also named esophageal cancer-related gene 2 (ECRG 2), is a member of the SPINK protease inhibitor family. It is thought to function as a tumor suppressor gene regulating the protease cascades during carcinogenesis and invasion of esophageal cancer by regulation of migration through urokinase-type plasmin activator/plasmin MAP kinase pathway.



