Tested Applications
| Positive WB detected in | A431 cells, mouse testis tissue, A549 cells, mouse epididymis tissue, rat testis tissue |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31931-1-AP targets SPINT3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35289 Product name: Recombinant human SPINT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-89 aa of NM_006652.1 Sequence: RDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT Predict reactive species |
| Full Name | serine peptidase inhibitor, Kunitz type, 3 |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | NM_006652.1 |
| Gene Symbol | SPINT3 |
| Gene ID (NCBI) | 10816 |
| RRID | AB_3742495 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P49223 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Serine peptidase inhibitor, Kunitz type 3 (SPINT3, also known as HKIB9) might be related to serine-type endopeptidase inhibitor activity, receptor antagonist activity, and transforming growth factor beta binding (PMID: 21988899). The calculated molecular weight of SPINT3 is 10 kDa, which is lower than its observed molecular weight of 30-35 kDa by SDS-PAGE detection (PMID: 21988899).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SPINT3 antibody 31931-1-AP | Download protocol |
| WB protocol for SPINT3 antibody 31931-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





