Product Information
31931-1-PBS targets SPINT3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35289 Product name: Recombinant human SPINT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-89 aa of NM_006652.1 Sequence: RDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT Predict reactive species |
| Full Name | serine peptidase inhibitor, Kunitz type, 3 |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | NM_006652.1 |
| Gene Symbol | SPINT3 |
| Gene ID (NCBI) | 10816 |
| RRID | AB_3742495 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P49223 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Serine peptidase inhibitor, Kunitz type 3 (SPINT3, also known as HKIB9) might be related to serine-type endopeptidase inhibitor activity, receptor antagonist activity, and transforming growth factor beta binding (PMID: 21988899). The calculated molecular weight of SPINT3 is 10 kDa, which is lower than its observed molecular weight of 30-35 kDa by SDS-PAGE detection (PMID: 21988899).





