SPINT3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPINT3 Polyclonal antibody, PBS Only (31931-1-PBS)

• 

  WB analysis using 31931-1-AP (same clone as 31931-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31931-1-AP (SPINT3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31931-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31931-1-AP (same clone as 31931-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31931-1-AP (SPINT3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31931-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31931-1-AP (same clone as 31931-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using SPINT3 antibody (31931-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 31931-1-PBS in a different storage buffer formulation.

SPINT3 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31931-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

HKIB9, Kunitz-type protease inhibitor 3

---

Product Information

31931-1-PBS targets SPINT3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35289

  Product name: Recombinant human SPINT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-89 aa of NM_006652.1

  Sequence: RDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT

• Full Name: serine peptidase inhibitor, Kunitz type, 3
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_006652.1
• Gene Symbol: SPINT3
• Gene ID (NCBI): 10816
• RRID: AB_3742495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P49223
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Serine peptidase inhibitor, Kunitz type 3 (SPINT3, also known as HKIB9) might be related to serine-type endopeptidase inhibitor activity, receptor antagonist activity, and transforming growth factor beta binding (PMID: 21988899). The calculated molecular weight of SPINT3 is 10 kDa, which is lower than its observed molecular weight of 30-35 kDa by SDS-PAGE detection (PMID: 21988899).