CD43 Polyclonal antibody

• 

  WB analysis of K-562 using 13959-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13959-1-AP (CD43 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13959-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13959-1-AP (CD43 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 13959-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13959-1-AP (CD43 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 13959-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13959-1-AP (CD43 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD43 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13959-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Leukosialin, Leukocyte sialoglycoprotein, GPL115, GALGP, Galactoglycoprotein

---

Tested Applications

• Positive WB detected in: K-562 cells, Jurkat cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13959-1-AP targets CD43 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4836

  Product name: Recombinant human SPN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 101-400 aa of BC012350

  Sequence: KMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP

• Full Name: sialophorin
• Calculated Molecular Weight: 400 aa, 43 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC012350
• Gene Symbol: CD43
• Gene ID (NCBI): 6693
• ENSEMBL Gene ID: ENSG00000197471
• RRID: AB_10694668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16150
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD43, also named leukosialin, sialophorin, galactoglycoprotein, leukocyte sialoglycoprotein, SPN, and is a mucin-like type I transmembrane protein. In humans, it is expressed in haematopoietic cells, including T lymphocytes, monocytes, granulocytes, natural killer cells, platelets, and haematopoietic stem cells, with the exception of mature erythrocytes and B cell subpopulations. The unglycosylated form of CD43 migrates on SDS-PAGE with a molecular weight of 54 kDa (PMID: 2943740), whereas CD43 from different haematopoietic cell lines displays increased molecular weights since it is glycosylated with O-linked chains that differ in core structure and sialylation.