CD43 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CD43 Monoclonal antibody (66224-1-Ig)

CD43 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66224-1-Ig

Clone No.2A11D6

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

2A11D6, CD43 cytoplasmic tail, Galactoglycoprotein, GALGP, GPL115

• 

  WB analysis of Jurkat using 66224-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66224-1-Ig (CD43 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 66224-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 66224-1-Ig (CD43 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 66224-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66224-1-Ig (CD43 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 66224-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD43 antibody (66224-1-Ig, Clone: 2A11D6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Jurkat using 66224-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using 66224-1-Ig (CD43 antibody) at dilution of 1:400 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells
• Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue
• Positive IF/ICC detected in: Jurkat cells, human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66224-1-Ig targets CD43 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23595

  Product name: Recombinant human SPN protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 101-400 aa of BC012350

  Sequence: KMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP

• Full Name: sialophorin
• Calculated Molecular Weight: 400 aa, 43 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC012350
• Gene Symbol: CD43
• Gene ID (NCBI): 6693
• ENSEMBL Gene ID: ENSG00000197471
• RRID: AB_2881615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16150
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD43, also named leukosialin, sialophorin, galactoglycoprotein, leukocyte sialoglycoprotein, SPN, and is a mucin-like type I transmembrane protein. In humans, it is expressed in haematopoietic cells, including T lymphocytes, monocytes, granulocytes, natural killer cells, platelets, and haematopoietic stem cells, with the exception of mature erythrocytes and B cell subpopulations. The unglycosylated form of CD43 migrates on SDS-PAGE with a molecular weight of 54 kDa (PMID: 2943740), whereas CD43 from different haematopoietic cell lines displays increased molecular weights since it is glycosylated with O-linked chains that differ in core structure and sialylation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; Incorporation of genome-bound cellular proteins into HIV-1 particles regulates viral infection.; Authors - Manuel Garcia-Moreno