Biotin-conjugated CD43 Monoclonal antibody

CD43 Monoclonal Antibody for FC (Intra)
Cat No. Biotin-66224
Clone No.2A11D6

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

FC (Intra)

2A11D6, CD43 cytoplasmic tail, Galactoglycoprotein, GALGP, GPL115

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-66224 targets CD43 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23595

Product name: Recombinant human SPN protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 101-400 aa of BC012350

Sequence: KMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP

Predict reactive species
Full Name sialophorin
Calculated Molecular Weight 400 aa, 43 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC012350
Gene Symbol CD43
Gene ID (NCBI) 6693
ENSEMBL Gene IDENSG00000197471
Conjugate Biotin
Excitation/Emission Maxima Wavelengths-
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16150
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD43, also named leukosialin, sialophorin, galactoglycoprotein, leukocyte sialoglycoprotein, SPN, and is a mucin-like type I transmembrane protein. In humans, it is expressed in haematopoietic cells, including T lymphocytes, monocytes, granulocytes, natural killer cells, platelets, and haematopoietic stem cells, with the exception of mature erythrocytes and B cell subpopulations. The unglycosylated form of CD43 migrates on SDS-PAGE with a molecular weight of 54 kDa (PMID: 2943740), whereas CD43 from different haematopoietic cell lines displays increased molecular weights since it is glycosylated with O-linked chains that differ in core structure and sialylation.

Protocols

Product Specific Protocols
FC protocol for Biotin CD43 antibody Biotin-66224Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...