Biotin-conjugated CD43 Monoclonal antibody

• 

  FC experiment of Jurkat using Biotin-66224

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug Biotin-conjugated CD43 Monoclonal antibody (Biotin-66224, Clone:2A11D6) and Streptavidin-PE Conjugate (PE-PF00030)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

CD43 Monoclonal Antibody for FC (Intra)

Cat No. Biotin-66224

Clone No.2A11D6

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

FC (Intra)

Synonyms

2A11D6, CD43 cytoplasmic tail, Galactoglycoprotein, GALGP, GPL115

---

Tested Applications

• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-66224 targets CD43 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23595

  Product name: Recombinant human SPN protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 101-400 aa of BC012350

  Sequence: KMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP

• Full Name: sialophorin
• Calculated Molecular Weight: 400 aa, 43 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC012350
• Gene Symbol: CD43
• Gene ID (NCBI): 6693
• ENSEMBL Gene ID: ENSG00000197471
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16150
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD43, also named leukosialin, sialophorin, galactoglycoprotein, leukocyte sialoglycoprotein, SPN, and is a mucin-like type I transmembrane protein. In humans, it is expressed in haematopoietic cells, including T lymphocytes, monocytes, granulocytes, natural killer cells, platelets, and haematopoietic stem cells, with the exception of mature erythrocytes and B cell subpopulations. The unglycosylated form of CD43 migrates on SDS-PAGE with a molecular weight of 54 kDa (PMID: 2943740), whereas CD43 from different haematopoietic cell lines displays increased molecular weights since it is glycosylated with O-linked chains that differ in core structure and sialylation.