SPOCK1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84977-1-RR (same clone as 84977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84977-1-RR (SPOCK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.ce This data was developed using the same antibody clone with 84977-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84977-1-RR (same clone as 84977-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84977-1-RR (SPOCK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84977-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84977-1-RR (same clone as 84977-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84977-1-RR (SPOCK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84977-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84977-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84977-1-RR against Human SPOCK1 were performed. The affinity constant is 3.51 nM.

SPOCK1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84977-1-PBS

Clone No.242196E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

242196E10, Protein SPOCK, SPOCK, TESTICAN, Testican 1

---

Product Information

84977-1-PBS targets SPOCK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28204

  Product name: Recombinant human SPOCK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-236 aa of BC030691

  Sequence: CVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGR

• Full Name: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1
• Calculated Molecular Weight: 439 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC030691
• Gene Symbol: SPOCK1
• Gene ID (NCBI): 6695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q08629
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPOCK1, also known as TICN1. It is predicted to be located in the extracellular matrix. The proein may play a role in cell-cell and cell-matrix interactions and may contribute to various neuronal mechanisms in the central nervous system. The molecular weight of SPOCK1 is 49 kDa.