SPOCK1 Recombinant monoclonal antibody

• 

  WB analysis using 84977-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84977-1-RR (SPOCK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.ce

• 

  IHC staining of human stomach cancer using 84977-1-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84977-1-RR (SPOCK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 84977-1-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84977-1-RR (SPOCK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84977-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84977-1-RR against Human SPOCK1 were performed. The affinity constant is 3.51 nM.

SPOCK1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84977-1-RR

Clone No.242196E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

242196E10, Protein SPOCK, SPOCK, TESTICAN, Testican 1

---

Tested Applications

• Positive WB detected in: DU 145 cells, PC-3 eclls, HEK-293T cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84977-1-RR targets SPOCK1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28204

  Product name: Recombinant human SPOCK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-236 aa of BC030691

  Sequence: CVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGR

• Full Name: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1
• Calculated Molecular Weight: 439 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC030691
• Gene Symbol: SPOCK1
• Gene ID (NCBI): 6695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q08629
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPOCK1, also known as TICN1. It is predicted to be located in the extracellular matrix. The proein may play a role in cell-cell and cell-matrix interactions and may contribute to various neuronal mechanisms in the central nervous system. The molecular weight of SPOCK1 is 49 kDa.