SPOPL Polyclonal antibody

• 

  WB analysis using 17740-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17740-1-AP (SPOPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SPOPL Polyclonal Antibody for WB, ELISA

Cat No. 17740-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HIB homolog 2, Roadkill homolog 2, speckle type POZ protein like, Speckle-type POZ protein-like

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17740-1-AP targets SPOPL in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11951

  Product name: Recombinant human SPOPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-392 aa of BC071613

  Sequence: MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSGPSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLKVPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQS

• Full Name: speckle-type POZ protein-like
• Calculated Molecular Weight: 392 aa, 45 kDa
• Observed Molecular Weight: 39-45 kDa
• GenBank Accession Number: BC071613
• Gene Symbol: SPOPL
• Gene ID (NCBI): 339745
• RRID: AB_3085537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IQ16
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Speckle Type POZ Protein Like (SPOPL), a member of the MATH-BTB protein family, was frst identifed in 2010 with 82.6% sequence homology with Speckle-type POZ protein (SPOP). SPOPL is an E3 ubiquitin ligase protein that ubiquitinates and degrades the target protein. SPOPL can be used as a potential prognostic biomarker for glioblastoma multiforme in clinical work and promotes the proliferation and stemness of glioma stem cells by activating the Notch signaling pathway (PMID:37523046).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Polydatin exerts therapeutic effects on myelodysplastic syndrome by inhibiting the protein expression of oncogenes via hypermethylation in vitro; Authors - Qingbing Zhou