SPOPL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPOPL Polyclonal antibody (17740-1-AP)

SPOPL Polyclonal Antibody for WB, ELISA

Cat No. 17740-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HIB homolog 2, Roadkill homolog 2, speckle type POZ protein like, Speckle-type POZ protein-like

• 

  WB analysis using 17740-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17740-1-AP (SPOPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPOPL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17740-1-AP targets SPOPL in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11951

  Product name: Recombinant human SPOPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-392 aa of BC071613

  Sequence: MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSGPSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLKVPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQS

• Full Name: speckle-type POZ protein-like
• Calculated Molecular Weight: 392 aa, 45 kDa
• Observed Molecular Weight: 39-45 kDa
• GenBank Accession Number: BC071613
• Gene Symbol: SPOPL
• Gene ID (NCBI): 339745
• RRID: AB_3085537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IQ16
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Speckle Type POZ Protein Like (SPOPL), a member of the MATH-BTB protein family, was frst identifed in 2010 with 82.6% sequence homology with Speckle-type POZ protein (SPOP). SPOPL is an E3 ubiquitin ligase protein that ubiquitinates and degrades the target protein. SPOPL can be used as a potential prognostic biomarker for glioblastoma multiforme in clinical work and promotes the proliferation and stemness of glioma stem cells by activating the Notch signaling pathway (PMID:37523046).

Publications

What published studies show

The SPOPL Polyclonal antibody (Cat# 17740-1-AP) has 1 total citation. The citation appears in Scientific Reports (2025), a study investigating how polydatin exerts therapeutic effects on myelodysplastic syndrome by inhibiting oncogene protein expression via hypermethylation in vitro. The research field encompasses hematological malignancies, specifically myelodysplastic syndrome, and involves epigenetic regulation of oncogenes. The antibody was applied in Western blot for human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Polydatin exerts therapeutic effects on myelodysplastic syndrome by inhibiting the protein expression of oncogenes via hypermethylation in vitro; Authors - Qingbing Zhou