Tested Applications
| Positive WB detected in | RT-4 cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27370-1-AP targets SPPL2B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25551 Product name: Recombinant human SPPL2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-113 aa of BC028391 Sequence: EGKDYCILYNPQWAHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGAR Predict reactive species |
| Full Name | signal peptide peptidase-like 2B |
| Calculated Molecular Weight | 65 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC028391 |
| Gene Symbol | SPPL2B |
| Gene ID (NCBI) | 56928 |
| RRID | AB_3742228 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TCT7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SPPL2B (Signal Peptide Peptidase-Like 2B) is a multi-pass transmembrane aspartyl protease belonging to the GXGD family of intramembrane proteases. SPPL2B contains two conserved catalytic aspartate motifs localized within its membrane-spanning regions, similar to presenilins and γ-secretase. It localizes primarily to endosomes, lysosomes, and the plasma membrane, distinguishing it from ER-resident SPP and SPPL3. (PMID: 32052089, PMID: 19429495)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SPPL2B antibody 27370-1-AP | Download protocol |
| WB protocol for SPPL2B antibody 27370-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



