Home
Products
Primary Antibodies
SPRR1B Polyclonal antibody, PBS Only (11959-1-PBS)

Filter: AllIHC

IHC staining of human skin using 11959-1-AP (same clone as 11959-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 11959-1-AP (SPRR1B Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11959-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 11959-1-AP (same clone as 11959-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 11959-1-AP (SPRR1B Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11959-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 11959-1-AP (same clone as 11959-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 11959-1-AP (SPRR1B Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11959-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 11959-1-AP (same clone as 11959-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 11959-1-AP (SPRR1B Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11959-1-PBS in a different storage buffer formulation.

SPRR1B Polyclonal antibody, PBS Only

Name: SPRR1B Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11959-1-PBS

SPRR1B Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 11959-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Cornifin-B, Small proline-rich protein IB, SPRIB, SPR-IB, SPRR1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11959-1-PBS targets SPRR1B in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2563 Product name: Recombinant human SPRR1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC056240 Sequence: MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK Predict reactive species
Full Name	small proline-rich protein 1B (cornifin)
Calculated Molecular Weight	89 aa, 10 kDa
GenBank Accession Number	BC056240
Gene Symbol	SPRR1B
Gene ID (NCBI)	6699
RRID	AB_2877807
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P22528
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

This protein functions as a component of the cross-linked envelope in squamous differentiating cells. It runs as a 15-kDa protein in unreducing SDS PAGE, whereas under reducing conditions it runs as 23 kDa one.