SPRR2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPRR2A Polyclonal antibody, PBS Only (26135-1-PBS)

• 

  IHC staining of human colon cancer using 26135-1-AP (same clone as 26135-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26135-1-AP (SPRR2A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26135-1-PBS in a different storage buffer formulation.

SPRR2A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26135-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

SPR 2A, SPR2A

---

Product Information

26135-1-PBS targets SPRR2A in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23537

  Product name: Recombinant human SPRR2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC096108

  Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

• Full Name: small proline-rich protein 2A
• GenBank Accession Number: BC096108
• Gene Symbol: SPRR2A
• Gene ID (NCBI): 6700
• RRID: AB_3742170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35326
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.