SPTAN1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 84761-2-RR (same clone as 84761-2-PBS)

  WB result of SPTAN1 antibody (84761-2-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPTAN1 transfected HeLa cells. This data was developed using the same antibody clone with 84761-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 84761-2-RR (same clone as 84761-2-PBS)

  Various lysates were subjected to SDS-PAGE followed by western blot with 84761-2-RR (SPTAN1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84761-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 84761-2-RR (same clone as 84761-2-PBS)

  mouse brain tissue were subjected to SDS-PAGE followed by western blot with 84761-2-RR (SPTAN1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84761-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84761-2-RR (same clone as 84761-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84761-2-RR (SPTAN1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84761-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84761-2-RR (same clone as 84761-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84761-2-RR (SPTAN1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84761-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84761-2-RR (same clone as 84761-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84761-2-RR (SPTAN1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84761-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84761-2-RR (same clone as 84761-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84761-2-RR (SPTAN1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84761-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84761-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84761-2-RR against Human SPTAN1 were performed. The affinity constant is 2.59 nM.

• Featured Product
• KD/KO Validated

SPTAN1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84761-2-PBS

Clone No.242104B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242104B7, Alpha II spectrin, NEAS, SPTA2

---

Product Information

84761-2-PBS targets SPTAN1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36472

  Product name: Recombinant human SPTAN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2315-2472 aa of NM_003127.3

  Sequence: RNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN

• Full Name: spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
• Calculated Molecular Weight: 285kDa，2472aa
• Observed Molecular Weight: 285 kDa,150 kDa
• GenBank Accession Number: NM_003127.3
• Gene Symbol: SPTAN1
• Gene ID (NCBI): 6709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13813
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPTAN1 (Nonerythroid spectrin αII), also termed α-Fodrin, is a cytoskeletal protein that belongs to the family of spectrins. Spectrins includes several structural proteins (α- and β-spectrin, α-actinin, dystrophin, and utrophin) that build and stabilize the cytoskeleton by forming a hexagonal mesh under the plasma membrane and ensuring stability and organization of organelles in the cell. SPTAN1 encodes for a 2,472 amino acid protein with a predicted molecular weight of 284 kDa and can be cleaved by calpain leading to a 150 kDa fragment (PMID: 31186638).