• Featured Product
  • KD/KO Validated

SPTAN1 Recombinant monoclonal antibody

SPTAN1 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84761-2-RR
Clone No.242104B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242104B7, Alpha II spectrin, NEAS, SPTA2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected in3T3-L1 cells, HeLa cells, mouse brain tissue, Jurkat cells, MDA-MB-231 cells, rat brain tissue
Positive IHC detected inmouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84761-2-RR targets SPTAN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag36472

Product name: Recombinant human SPTAN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2315-2472 aa of NM_003127.3

Sequence: RNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN

Predict reactive species
Full Name spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
Calculated Molecular Weight285kDa,2472aa
Observed Molecular Weight285 kDa,150 kDa
GenBank Accession NumberNM_003127.3
Gene Symbol SPTAN1
Gene ID (NCBI) 6709
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13813
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPTAN1 (Nonerythroid spectrin αII), also termed α-Fodrin, is a cytoskeletal protein that belongs to the family of spectrins. Spectrins includes several structural proteins (α- and β-spectrin, α-actinin, dystrophin, and utrophin) that build and stabilize the cytoskeleton by forming a hexagonal mesh under the plasma membrane and ensuring stability and organization of organelles in the cell. SPTAN1 encodes for a 2,472 amino acid protein with a predicted molecular weight of 284 kDa and can be cleaved by calpain leading to a 150 kDa fragment (PMID: 31186638).

Protocols

Product Specific Protocols
IHC protocol for SPTAN1 antibody 84761-2-RRDownload protocol
WB protocol for SPTAN1 antibody 84761-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...