SPTBN1 Monoclonal antibody

SPTBN1 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67978-1-Ig
Clone No.1E1D1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit, pig and More (1)

Applications

WB, IHC, ELISA

Beta II spectrin, betaSpII, ELF, Fodrin beta chain, Spectrin beta chain, brain 1, SPTB2, SPTBN1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse cerebellum tissue, HepG2 cells, Jurkat cells, pig brain, rabbit brain, rat brain, mouse brain, rat cerebellum
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

67978-1-Ig targets SPTBN1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

Tested Reactivity Human, mouse, rat, rabbit, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31713

Product name: Recombinant human SPTBN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 633-820 aa of BC137282

Sequence: EMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKE

Predict reactive species
Full Name spectrin, beta, non-erythrocytic 1
Calculated Molecular Weight 2364 aa, 275 kDa
Observed Molecular Weight250-275 kDa
GenBank Accession NumberBC137282
Gene Symbol SPTBN1
Gene ID (NCBI) 6711
RRIDAB_2918727
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01082
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPTBN1 is the non-erythrocytic form of β-spectrin or β-fodrin. Spectrins are members of the superfamily of F-actin cross linking proteins that are important as scaffolding proteins for protein sorting, cell adhesion, and migration. Reduced expression of SPTBN1 has been found to correlate with shorter survival of patients with hepatocellular cancer, pancreatic cancer and other malignancies of the gastrointestinal tract, suggesting tumor suppression ability of this protein.

Protocols

Product Specific Protocols
IHC protocol for SPTBN1 antibody 67978-1-IgDownload protocol
WB protocol for SPTBN1 antibody 67978-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

BMC Cancer

Clinical significance of nonerythrocytic spectrin Beta 1 (SPTBN1) in human kidney renal clear cell carcinoma and uveal melanoma: a study based on Pan-Cancer Analysis

Authors - Wenting Tang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marina (Verified Customer) (03-15-2024)

Samples are two tumour (glioblastoma) cell lines (TC1, TC2). Gradient gel 4-15 %. Dilution 1:5000, primary antibody incubation 4ºC overnight, secondary antibody incubation 1 h room temperature. The bands appear at the expected size of the target protein.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Human tumour cell lines
SPTBN1 Antibody Western Blot validation (1:5000 dilution) in Human tumour cell lines (Cat no:67978-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...