• Featured Product
  • KD/KO Validated

SPTLC1 Monoclonal antibody, PBS Only (Detector)

SPTLC1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66899-1-PBS
Clone No.2D11D7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Serine-palmitoyl-CoA transferase 1, LCB1, LCB 1, HSAN1, EC:2.3.1.50

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66899-1-PBS targets SPTLC1 as part of a matched antibody pair:

MP50865-2: 66899-4-PBS capture and 66899-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7876

Product name: Recombinant human SPTLC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-143 aa of BC007085

Sequence: MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFE

Predict reactive species
Full Name serine palmitoyltransferase, long chain base subunit 1
Calculated Molecular Weight 53 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC007085
Gene Symbol SPTLC1
Gene ID (NCBI) 10558
RRIDAB_2882228
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15269
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SPTLC1 is a subunit of serine palmitoyltransferase (SPT) which is the key enzyme in sphingolipid biosynthesis and is essential for embryogenesis and cell survival. Mutations in the SPTLC1 gene (C133W, C133Y, V144D, and G387A) were reported to be responsible for the development of an inherited sensory neuropathy (hereditary sensory neuropathy type I, HSN1).

Loading...
||
New chat Able
正在加载,请稍候...