SQRDL Recombinant monoclonal antibody

• 

  WB analysis using 83960-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83960-3-RR (SQRDL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83960-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83960-3-RR against Human SQRDL were performed. The affinity constant is 0.126 nM.

SQRDL Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83960-3-RR

Clone No.241226E8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Sulfide dehydrogenase-like, SQOR, EC:1.8.5.8, CGI-44, CGI 44

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, HT-29 cells, THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83960-3-RR targets SQRDL in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10762

  Product name: Recombinant human SQRDL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-450 aa of BC016836

  Sequence: GRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

• Full Name: sulfide quinone reductase-like (yeast)
• Calculated Molecular Weight: 450 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC016836
• Gene Symbol: SQRDL
• Gene ID (NCBI): 58472
• RRID: AB_3671539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y6N5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.