FDFT1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00097-1

  Sandwich ELISA standard curve of MP00097-1, Human FDFT1 Recombinant Matched Antibody Pair - PBS only. 83020-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag3743. 83020-4-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

• 

  Sample test of MP00097-1

  Serum of eight individual healthy human donors was measured. The FDFT1 concentration of detected samples was determined to be 1,817 pg/mL with a range of 368 - 5,103 pg/mL.

• 

  Sample test of MP00097-1

  The mean FDFT1 concentration was determined to be 8.7 ng/mL in HeLa cell extract based on a 1.5 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP00097-1

  Cytometric bead array standard curve of MP00097-1, SQS/FDFT1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83020-2-PBS. Detection antibody: 83020-4-PBS. Standard: Ag3743. Range: 0.625-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 83020-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 83020-4-PBS against Human FDFT1 was performed. The affinity constant is below 1 pM.

FDFT1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83020-4-PBS

Clone No.230362F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

DGPT, EC:2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase, Farnesyl-diphosphate farnesyltransferase 1

---

Product Information

83020-4-PBS targets FDFT1 as part of a matched antibody pair:

MP00097-1: 83020-2-PBS capture and 83020-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3743

  Product name: Recombinant human SQS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-358 aa of BC029641

  Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK

• Full Name: farnesyl-diphosphate farnesyltransferase 1
• Calculated Molecular Weight: 417 aa, 48 kDa
• GenBank Accession Number: BC029641
• Gene Symbol: FDFT1
• Gene ID (NCBI): 2222
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37268
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.