• Featured Product
  • KD/KO Validated

SRD5A1 Monoclonal antibody, PBS Only (Capture)

SRD5A1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66329-1-PBS
Clone No.1D5D8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Steroid 5 alpha reductase 1, SR type 1, S5AR 1, EC:1.3.1.22, 3-oxo-5-alpha-steroid 4-dehydrogenase 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66329-1-PBS targets SRD5A1 as part of a matched antibody pair:

MP50930-1: 66329-1-PBS capture and 66329-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23351

Product name: Recombinant human SRD5A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-163 aa of BC007033

Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML

Predict reactive species
Full Name steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC007033
Gene Symbol SRD5A1
Gene ID (NCBI) 6715
RRIDAB_2881710
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18405
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Steroid 5-alpha-reductase (SRD5A1)   is a minor component of the reductase activity in prostate although the gene was originally cloned from prostate. On the other hand, SRD5A1 appears to be the predominant isozyme of steroid 5-alpha-reductase in the scalp and elsewhere in the skin.

Loading...
||
New chat Able
正在加载,请稍候...