SRD5A1 Monoclonal antibody

• 

  WB analysis of human testis using 66329-1-Ig

  human testis tissue were subjected to SDS PAGE followed by western blot with 66329-1-Ig (SRD5A1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 66329-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66329-1-Ig (SRD5A1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 66329-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66329-1-Ig (SRD5A1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 66329-1-Ig

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed HeLa cells using 66329-1-Ig(SRD5A1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HEPG2 using 66329-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HEPG2 cells using SRD5A1 antibody (66329-1-Ig, Clone: 1D5D8 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

SRD5A1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66329-1-Ig

Clone No.1D5D8

Publications(6)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

S5AR 1, SR type 1, SRD5A1, Steroid 5 alpha reductase 1

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HEPG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 2 publications below

Product Information

66329-1-Ig targets SRD5A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23351

  Product name: Recombinant human SRD5A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC007033

  Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML

• Full Name: steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC007033
• Gene Symbol: SRD5A1
• Gene ID (NCBI): 6715
• RRID: AB_2881710
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P18405
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Steroid 5-alpha-reductase (SRD5A1)   is a minor component of the reductase activity in prostate although the gene was originally cloned from prostate. On the other hand, SRD5A1 appears to be the predominant isozyme of steroid 5-alpha-reductase in the scalp and elsewhere in the skin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Sci; Modulation of AKR1C2 by curcumin decreases testosterone production in prostate cancer.; Authors - Hisamitsu Ide
	WB	Sci Rep; Expression of steroidogenic enzymes and metabolism of steroids in COS-7 cells known as non-steroidogenic cells.; Authors - Mitsuki Nozaki
human	WB,IHC	Front Oncol; Steroid 5α-Reductase Type I Induces Cell Viability and Migration via Nuclear Factor-κB/Vascular Endothelial Growth Factor Signaling Pathway in Colorectal Cancer.; Authors - Rongfang Wei ; KD Validated
human	WB	In Vivo; Effects of Curcumin Combined With the 5-alpha Reductase Inhibitor Dutasteride on LNCaP Prostate Cancer Cells.; Authors - Akinori Nakayama
human	WB	Cell Death Dis; Suppression of steroid 5α-reductase type I promotes cellular apoptosis and autophagy via PI3K/Akt/mTOR pathway in multiple myeloma.; Authors - Renjie Dou ; KD Validated
mouse	IHC	Nat Commun; The estrous cycle modulates early-life adversity effects on mouse avoidance behavior through progesterone signaling; Authors - Blake J Laham