SRI Polyclonal antibody

• 

  WB analysis of mouse liver using 16471-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 16471-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16471-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 16471-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 16471-1-AP

  IP result of anti-SRI (IP:16471-1-AP, 3ug; Detection:16471-1-AP 1:500) with HepG2 cells lysate 600ug.

• 

  IHC staining of human liver using 16471-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16471-1-AP (SRI antibody) at dilution of 1:500 (under 10x lens).

• 

  IHC staining of human liver using 16471-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16471-1-AP (SRI antibody) at dilution of 1:500 (under 40x lens).

• 

  IF Staining of HepG2 using 16471-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SRI antibody (16471-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

SRI Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16471-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

22 kDa protein, CP 22, SCN, sorcin, SRI, V19

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HepG2 cells, human liver tissue, rat liver tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 2 publications below
• IF: See 3 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

16471-1-AP targets SRI in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9553

  Product name: Recombinant human SRI protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-198 aa of BC011025

  Sequence: MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

• Full Name: sorcin
• Calculated Molecular Weight: 198 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC011025
• Gene Symbol: SRI
• Gene ID (NCBI): 6717
• RRID: AB_2255255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30626
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Physiol; Targeting P-glycoprotein and SORCIN: Dihydromyricetin strengthens anti-proliferative efficiency of adriamycin via MAPK/ERK and Ca(2+) -mediated apoptosis pathways in MCF-7/ADR and K562/ADR.; Authors - Yaoting Sun
human	WB	J Cell Physiol; PMID: 30171603; Authors - Yaoting Sun
mouse	IF, WB	Arch Biochem Biophys; Knockdown of sorcin increases HEI-OC1 cell damage induced by cisplatin in vitro.; Authors - Dan Wang
human	WB,IHC,IF,IP	Cell Death Dis; AnnexinA7 promotes epithelial-mesenchymal transition by interacting with Sorcin and contributes to aggressiveness in hepatocellular carcinoma.; Authors - Fei Ling
human	WB	J Physiol Biochem; Sorcin promotes proliferation of hepatocellular carcinoma by regulating VEGFA/B via PI3K pathway; Authors - Huan Zhang
human,mouse	WB,IHC,IF,CoIP	Int J Mol Sci; Sorcin Inhibits Mitochondrial Apoptosis by Interacting with STAT3 via NF-κB Pathway; Authors - Yizi Li