SRI Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SRI Polyclonal antibody, PBS Only (16471-1-PBS)

• 

  WB analysis of mouse liver using 16471-1-AP (same clone as 16471-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 16471-1-AP (same clone as 16471-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 16471-1-AP (same clone as 16471-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 16471-1-AP (same clone as 16471-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 16471-1-AP (SRI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 16471-1-AP (same clone as 16471-1-PBS)

  IP result of anti-SRI (IP:16471-1-AP, 3ug; Detection:16471-1-AP 1:500) with HepG2 cells lysate 600ug. This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16471-1-AP (same clone as 16471-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16471-1-AP (SRI antibody) at dilution of 1:500 (under 10x lens). This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16471-1-AP (same clone as 16471-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16471-1-AP (SRI antibody) at dilution of 1:500 (under 40x lens). This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16471-1-AP (same clone as 16471-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SRI antibody (16471-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 16471-1-PBS in a different storage buffer formulation.

SRI Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16471-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

16471-1-PBS targets SRI in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9553

  Product name: Recombinant human SRI protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-198 aa of BC011025

  Sequence: MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

• Full Name: sorcin
• Calculated Molecular Weight: 198 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC011025
• Gene Symbol: SRI
• Gene ID (NCBI): 6717
• RRID: AB_2255255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30626
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.