Tested Applications
| Positive WB detected in | HeLa cells, LNCaP cells, HepG2 cells, PC-3 cells, mouse liver tissue, rat liver tissue, RAW 264.7 cells, mouse brain tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human kidney tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19858-1-AP targets Spermidine synthase in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13936 Product name: Recombinant human SRM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC000309 Sequence: MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS Predict reactive species |
| Full Name | spermidine synthase |
| Calculated Molecular Weight | 302 aa, 34 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC000309 |
| Gene Symbol | Spermidine synthase |
| Gene ID (NCBI) | 6723 |
| RRID | AB_10665555 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19623 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Spermidine synthase is an enzyme that catalyzes the transfer of the propylamine group from S-adenosylmethioninamine to putrescine in the biosynthesis of spermidine. The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthases catalyze the production of the linear triamine, spermidine, from putrescine. They utilize decarboxylated S-adenosylmethionine (dc-SAM), a universal cofactor of aminopropyltransferases, as a donor of the aminopropyl moiety (PMID:31134111).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Spermidine synthase antibody 19858-1-AP | Download protocol |
| IHC protocol for Spermidine synthase antibody 19858-1-AP | Download protocol |
| IP protocol for Spermidine synthase antibody 19858-1-AP | Download protocol |
| WB protocol for Spermidine synthase antibody 19858-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SRM (Spermidine Synthase) antibody (Cat# 19858-1-AP) has 25 citations across journals including Nature, Cell, Cell Metabolism, Cancer Research, Nature Communications, JCI, Cell Death & Disease, PNAS Nexus, and FASEB Journal. Research fields span polyamine metabolism, ferroptosis, cancer (bladder, prostate, colorectal, lung), neurodegeneration, metabolic regulation, insulin signaling, and muscle physiology, with applications primarily in WB and IF.
| Species | Application | Title |
|---|---|---|
Cell Metab Arachidonic acid triggers spermidine synthase secretion from primary tumor to induce skeletal muscle weakness upon irradiation | ||
Cancer Res A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer
| ||
Nat Commun Macrophage ABHD5 promotes colorectal cancer growth by suppressing spermidine production by SRM. | ||
J Nanobiotechnology Growth hormone-releasing peptide 6 (GHRP-6) hydrogel for acute kidney injury therapy via metabolic regulation. |
Reviews
What customers say
The product has received one review with a 4-star rating. The reviewer used the antibody for Western Blot on mouse liver tissue at a 1:1000 dilution and described it as a "good antibody," indicating satisfactory performance for their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (08-15-2024) | Good antibody.
 |
