SRY Polyclonal antibody

SRY Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17930-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

sex determining region Y, SRY, TDF, TDY, Testis determining factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue
Positive IHC detected inmouse testis tissue, human testis tissue, human spleen tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17930-1-AP targets SRY in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12360

Product name: Recombinant human SRY protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-204 aa of BC074924

Sequence: MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL

Predict reactive species
Full Name sex determining region Y
Calculated Molecular Weight 204 aa, 24 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC074924
Gene Symbol SRY
Gene ID (NCBI) 6736
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ05066
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SRY (sex-determining region Y protein) is a tran-scriptional activator required for male sex determination in mammals. This protein, also referred to as testis-determining factor (TDF), is an HMG box protein that initiates the formation of testis from undifferentiated gonad. The DNA-binding activity of SRY is required for normal testis formation. This DNA-binding activity is thought to be regulated by PKA, which phosphorylates SRY in vivo. Mutations in SRY have been associated with 46,XY gonadal dysgenesis, in which the gonads fail to develop in XY phenotypic females.

Loading...
||
New chat Able
正在加载,请稍候...