SRp20 Recombinant monoclonal antibody

• 

  WB analysis using 87438-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87438-1-RR (SRp20 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87438-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87438-1-RR against Human SRp20 were performed. The affinity constant is 4.07 nM.

SRp20 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87438-1-RR

Clone No.252792A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SFRS3, Pre-mRNA-splicing factor SRP20, Serine/arginine-rich splicing factor 3, SFRS 3, Splicing factor, arginine/serine-rich 3

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, RAW 264.7 cells, NIH/3T3 cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87438-1-RR targets SRp20 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1341

  Product name: Recombinant human SRp20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC000914

  Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK

• Full Name: splicing factor, arginine/serine-rich 3
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20-24 kDa
• GenBank Accession Number: BC000914
• Gene Symbol: SRSF3
• Gene ID (NCBI): 6428
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P84103
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFRS3, also named as SRSF3 and SRP20, belongs to the splicing factor SR family. It may be involved in RNA processing in relation with cellular proliferation and/or maturation. SFRS3 is one of the cognate factors. It is a proto-oncogene critical for cell proliferation and tumor induction and maintenance.