TRAPB/SSR2 Polyclonal antibody

• 

  WB analysis using 10278-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10278-1-AP (TRAPB/SSR2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 10278-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10278-1-AP (TRAPB/SSR2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 10278-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10278-1-AP (TRAPB/SSR2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas using 10278-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 10278-1-AP (TRAPB/SSR2 antibody at dilution of 1:50.

• 

  IHC staining of human pancreas using 10278-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 10278-1-AP (TRAPB/SSR2 antibody at dilution of 1:50.

• 

  IF Staining of HepG2 using 10278-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TRAPB/SSR2 antibody (10278-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TRAPB/SSR2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10278-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

SSR2, Translocon-associated protein subunit beta, TLAP, SSR-beta, SSR beta

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human breast cancer tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 2 publications below
• IP: See 1 publications below

Product Information

10278-1-AP targets TRAPB/SSR2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0304

  Product name: Recombinant human TRAPB, SSR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC000341

  Sequence: MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKY

• Full Name: signal sequence receptor, beta (translocon-associated protein beta)
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC000341
• Gene Symbol: TRAPB
• Gene ID (NCBI): 6746
• RRID: AB_2195624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43308
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRAPB (translocon-associated protein subunit beta), also known as SSR2 (signal sequence receptor subunit beta), is a 22-kDa single-spanning membrane glycoprotein of the endoplasmic reticulum (ER) (PMID: 7789174). It is a part of the tetrameric TRAP complex (TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma) which functions in regulating the retention of ER resident proteins (PMID: 7916687). The TRAP complex is also involved in endoplasmic reticulum-associated degradation (ERAD) (PMID: 17380188).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; RNF126-Mediated Reubiquitination Is Required for Proteasomal Degradation of p97-Extracted Membrane Proteins.; Authors - Xianyan Hu
human	WB	Sci Adv; The translocon-associated protein (TRAP) complex regulates quality control of N-linked glycosylation during ER stress.; Authors - Chatchai Phoomak
human	WB	Diabetes; The Role of TRAPγ/SSR3 in Preproinsulin Translocation into the Endoplasmic Reticulum.; Authors - Xiaoxi Xu
rat	WB, IP	FASEB J; Deficient endoplasmic reticulum translocon-associated protein complex limits the biosynthesis of proinsulin and insulin.; Authors - Yumeng Huang ; KD Validated
human	WB,IHC	J Cell Mol Med; Overexpression of SSR2 promotes proliferation of liver cancer cells and predicts prognosis of patients with hepatocellular carcinoma.; Authors - Fengsui Chen ; KD Validated
human	WB	J Exp Clin Cancer Res; Long noncoding RNA SNHG14 promotes hepatocellular carcinoma progression by regulating miR-876-5p/SSR2 axis.; Authors - Zhibin Liao