ST3GAL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ST3GAL2 Polyclonal antibody, PBS Only (13620-1-PBS)

• 

  WB analysis using 13620-1-AP (same clone as 13620-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13620-1-AP (ST3GAL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13620-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13620-1-AP (same clone as 13620-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13620-1-AP (ST3GAL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13620-1-PBS in a different storage buffer formulation.

ST3GAL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13620-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Alpha 2,3-ST 2, Beta-galactoside alpha-2,3-sialyltransferase 2, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2, EC:2.4.3.2, EC:2.4.3.4

---

Product Information

13620-1-PBS targets ST3GAL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4528

  Product name: Recombinant human ST3GAL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-210 aa of BC036777

  Sequence: SHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPA

• Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 2
• Calculated Molecular Weight: 350 aa, 40 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC036777
• Gene Symbol: ST3GAL2
• Gene ID (NCBI): 6483
• RRID: AB_2286561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16842
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta-galactoside alpha-2,3-sialyltransferase 2 (ST3GAL2) is a sialyltransferase (ST) that transfers sialic acid from the activated donor CMP-sialic acid to the glycan terminus of a glycolipid or glycoprotein. ST3GAL2 contains two putative N-glycosylation sites (Asn92 and Asn211), which are mainly responsible for GD1a and GT1b ganglioside biosynthesis in the brain. ST3GAL2 belongs to the sialyltransferase family, which mediates the terminal modification of glycoproteins and glycolipids. ST3GAL2 has been found to play a role in obesity, aging, and malignant diseases (PMID: 34319453). The calculated molecular weight of ST3GAL2 is 40 kDa.