ST3GAL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ST3GAL3 Polyclonal antibody, PBS Only (24925-1-PBS)

• 

  WB analysis of mouse liver using 24925-1-AP (same clone as 24925-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24925-1-AP (ST3GAL3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24925-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 24925-1-AP (same clone as 24925-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24925-1-AP (ST3GAL3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24925-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 24925-1-AP (same clone as 24925-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24925-1-AP (ST3GAL3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24925-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ST3GAL3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24925-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24925-1-PBS targets ST3GAL3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20795

  Product name: Recombinant human ST3GAL3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 203-375 aa of BC050380

  Sequence: TTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

• Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 3
• Calculated Molecular Weight: 375 aa, 42 kDa
• Observed Molecular Weight: 44-55 kDa
• GenBank Accession Number: BC050380
• Gene Symbol: ST3GAL3
• Gene ID (NCBI): 6487
• RRID: AB_2879799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q11203
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.