ST3GAL6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ST3GAL6 Polyclonal antibody, PBS Only (13154-1-PBS)

• 

  WB analysis using 13154-1-AP (same clone as 13154-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13154-1-AP (ST3GAL6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13154-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 13154-1-AP (same clone as 13154-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 13154-1-AP (ST3GAL6 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13154-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 13154-1-AP (same clone as 13154-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13154-1-AP (ST3GAL6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13154-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 13154-1-AP (same clone as 13154-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 13154-1-AP (ST3GAL6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13154-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 13154-1-AP (same clone as 13154-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 13154-1-AP (ST3GAL6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13154-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 13154-1-AP (same clone as 13154-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13154-1-AP (ST3GAL6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13154-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ST3GAL6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13154-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13154-1-PBS targets ST3GAL6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3782

  Product name: Recombinant human ST3GAL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-331 aa of BC023312

  Sequence: GTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD

• Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 6
• Calculated Molecular Weight: 331 aa, 38 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC023312
• Gene Symbol: ST3GAL6
• Gene ID (NCBI): 10402
• RRID: AB_10646441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y274
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ST3GAL6, also named as SIAT10, belongs to the glycosyltransferase 29 family. ST3GAL6 is involved in the synthesis of sialyl-paragloboside, which is a precursor of sialyl-Lewis X determinant. ST3GAL6 has a alpha-2,3-sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. ST3GAL6 is known to promote cell adhesion and migration of multiple myeloma cells by increasing the synthesis of selectin ligands. ST3GAL6 has 2 isoforms with the molecular mass of 25 and 38 kDa. Sometimes higher molecular weight about 50-60 kDa can also be observed, which may be a glycosylated modified variant of ST3GAL6. (PMID: 31914669, 30220088)