ST6GALNAC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ST6GALNAC1 Polyclonal antibody, PBS Only (15363-1-PBS)

• 

  WB analysis using 15363-1-AP (same clone as 15363-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15363-1-AP (ST6GALNAC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15363-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 15363-1-AP (same clone as 15363-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15363-1-AP (ST6GALNAC1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15363-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 15363-1-AP (same clone as 15363-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15363-1-AP (ST6GALNAC1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15363-1-PBS in a different storage buffer formulation.

ST6GALNAC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15363-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SIAT7 A, HSY11339, hST6GalNAc-I, GalNAc alpha-2,6-sialyltransferase I, EC:2.4.3.3

---

Product Information

15363-1-PBS targets ST6GALNAC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8062

  Product name: Recombinant human ST6GALNAC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 120-471 aa of BC022462

  Sequence: QRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTKGNGGQTRKLTASRTVSEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPFQSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPNLTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSLRCITCAVVGNGGILNNSHIGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKAQTPGSFSGSPAHGQVPVAAPRLSPIHEEQVSEV

• Full Name: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 66-69 kDa
• GenBank Accession Number: BC022462
• Gene Symbol: ST6GALNAC1
• Gene ID (NCBI): 55808
• RRID: AB_2286578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSC7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ST6GALNAC1 encodes a sialyltransferase that acts as a catalyst for the synthesis of cancer-related sialylTn (sTn) antigen critical for cell mobility.ST6GALNAC1 was overexpressed in gastric, breast and prostate cancer cell lines, inducing sTn expression.